PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK21094.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 467aa    MW: 52052.4 Da    PI: 9.8264
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK21094.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding262.1e-08129172347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE ++l  ++kq+  + +  Ia ++++ Rt +++k+r++++
        PK21094.1 129 AWTKEETDQLFSLCKQFDLR-FIIIADRFPTSRTVEELKDRYYNV 172
                      7*******************.**********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162823.8E-32102176IPR032563DAMP1, SANT/Myb-like domain
Gene3DG3DSA:1.10.10.606.7E-7125174IPR009057Homeodomain-like
SuperFamilySSF466892.69E-7126177IPR009057Homeodomain-like
SMARTSM007171.1E-8126175IPR001005SANT/Myb domain
CDDcd116585.60E-19130173No hitNo description
PfamPF054991.6E-7321385IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MDAKDILGLP KNALPVAQEK KSRPQKDSHR KPDGISREVY ALTGGVPPLM PSIDLSQLRK  60
RPPADEKITW QWLPFTSSAR KDNLQLYHWV RVVNGAPPTG DYSFAKYNKS VDIVQYTDEE  120
YEKHLTDPAW TKEETDQLFS LCKQFDLRFI IIADRFPTSR TVEELKDRYY NVCRALVVAR  180
APSPVDVSGH PVVKEPYNVS QEKERKRALS MVLSQTKLQE KKDVEVLSEA KKITESRLAA  240
KVAEEVELPV ASNVATENTE KTTIPGDIVS PSPSVPVPSA VVAAVPSTLA ADNAATVASL  300
RMLRVYLRTY ALDQMIQAAS ASAGLRTIKR VEQTLQELGV NLKPRVPTKA VCAEHLELRK  360
EILTLLNLQK QVQYKETENS SFRDNPYEAP GTPKDRMFVP DSMNFGVSGE RPGKRDQKRK  420
GPGRGSEAPS SPAQSNKRPR KLKASDLCSL ELRWQNISLL NGTGGRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A7e-23101186493DNA methyltransferase 1-associated protein 1
4iej_A7e-23101186493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094407.10.0DNA methyltransferase 1-associated protein 1
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLW9R6Q20.0W9R6Q2_9R
STRINGPOPTR_0014s11270.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49752330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein